PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013677P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 269aa    MW: 30376.7 Da    PI: 6.9169
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013677P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.5e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +l++ v ++G ++W+ Ia+  g++Rt+k+c++rw +yl
   MELO3C013677P1  9 KGPWTEQEDIQLICFVGLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 56
                     79********************************************97 PP

2Myb_DNA-binding55.51.3e-1762107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++Tt+E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
   MELO3C013677P1  62 RGKMTTQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 107
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.755456IPR017930Myb domain
SuperFamilySSF466892.9E-296103IPR009057Homeodomain-like
SMARTSM007171.8E-15858IPR001005SANT/Myb domain
PfamPF002498.2E-16956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-191063IPR009057Homeodomain-like
CDDcd001671.14E-101156No hitNo description
PROSITE profilePS5129427.06657111IPR017930Myb domain
SMARTSM007171.2E-1661109IPR001005SANT/Myb domain
PfamPF002491.1E-1562106IPR001005SANT/Myb domain
CDDcd001671.63E-1164107No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2364110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MVEGQEIRKG PWTEQEDIQL ICFVGLFGDR RWDFIAKVSG LNRTGKSCRL RWVNYLHPGL  60
KRGKMTTQEE RLVLELHAKW GNRWSKIARK LPGRTDNEIK NYWRTHMRKK AQEKRRGLSA  120
SSSSSSSSSS SSSSSSSSSF NNPAKEFPAD TGPVKFFDSG GSEISASSST KKKIEENQEL  180
GGGDQNGYTM DDIWKDIEVS NHESLIMNQD VYSEDNNFSC PALNSAASSW EDYYCGDSLW  240
KMEEEESKLI FSGWPCLGLA QPNQNFFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-2961111105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN8114400.0LN811440.1 Lilium hybrid division I mRNA for MYB48, cultivar Prato.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448372.10.0PREDICTED: transcription factor MYB48-like isoform X1
SwissprotQ9LX822e-87MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0D6E2901e-176A0A0D6E290_9LILI; MYB48
STRINGVIT_06s0004g04140.t011e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.11e-80myb domain protein 48